Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNE2 Peptide - middle region

KCNE2 Peptide - middle region

Product Specifications

Product Name Alternative

LQT5, LQT6, ATFB4, MIRP1

UniProt

Q9Y6J6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KCNE2 Rabbit Polyclonal Antibody (orb589672) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_751951.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MVMIGMFSFIIVAILVSTVKSKRREHSNDPYHQYIVEDWQEKYKSQILNL

More Discoveries

Explore Other Products

Browse additional items from our catalog

P38δ MAPK Rabbit mAb
F1367-100uL*2 2x 100 μL

P38δ MAPK Rabbit mAb

Sign In for Pricing
View Details
SPR, CT (SPR, Sepiapterin reductase) (FITC) discontinued
042258-FITC 200 µL

SPR, CT (SPR, Sepiapterin reductase) (FITC) discontinued

Sign In for Pricing
View Details
hsa-miR-4474-5p miRNA Antagomir
MBS8317353-01 10 nmol

hsa-miR-4474-5p miRNA Antagomir

Sign In for Pricing
View Details
hsa-miR-4474-5p miRNA Antagomir
MBS8317353-02 20 nmol

hsa-miR-4474-5p miRNA Antagomir

Sign In for Pricing
View Details
hsa-miR-4474-5p miRNA Antagomir
MBS8317353-03 5x 20 nmol

hsa-miR-4474-5p miRNA Antagomir

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana 17.4 kDa class I heat shock protein (HSP17.4A)
MBS1191418-01 0.02 mg (E-Coli)

Recombinant Arabidopsis thaliana 17.4 kDa class I heat shock protein (HSP17.4A)

Sign In for Pricing
View Details