Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COL4A5 Peptide - middle region

COL4A5 Peptide - middle region

Product Specifications

Product Name Alternative

ATS, ASLN, CA54

UniProt

Q49AM6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with COL4A5 Rabbit Polyclonal Antibody (orb589678) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_000486.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PGPPGSPGDKGLQGEQGVKGDKGDTCFNCIGTGISGPPGQPGLPGLPGPP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AU*Polyclonal  Goat Anti-HBcAg
C030311-10ml 10ml

AU*Polyclonal Goat Anti-HBcAg

Sign In for Pricing
View Details
Naca (NM_001105939) Rat Tagged ORF Clone Lentiviral Particle
RR213169L3V 200 µL

Naca (NM_001105939) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Mouse Monoclonal CLEC4D/CLECSF8 Antibody (9B9) [mFluor Violet 610 SE]
NBP3-18866MFV610 0.1 mL

Mouse Monoclonal CLEC4D/CLECSF8 Antibody (9B9) [mFluor Violet 610 SE]

Sign In for Pricing
View Details
Rttn Mouse shRNA Lentiviral Particle (Locus ID 246102)
TL512217V 500 µL Each

Rttn Mouse shRNA Lentiviral Particle (Locus ID 246102)

Sign In for Pricing
View Details
Mouse Monoclonal RBFOX3/NeuN Antibody (CL11896)
NBP3-21203-100ul 100 µL

Mouse Monoclonal RBFOX3/NeuN Antibody (CL11896)

Sign In for Pricing
View Details
FBPase-IN-1
BA7724-10 10 mg

FBPase-IN-1

Sign In for Pricing
View Details