Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COL4A5 Peptide - middle region

COL4A5 Peptide - middle region

Product Specifications

Product Name Alternative

ATS, ASLN, CA54

UniProt

Q49AM6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with COL4A5 Rabbit Polyclonal Antibody (orb589678) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_000486.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PGPPGSPGDKGLQGEQGVKGDKGDTCFNCIGTGISGPPGQPGLPGLPGPP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prss28 HDR Plasmid (m)
sc-431121-HDR 20 µg

Prss28 HDR Plasmid (m)

Sign In for Pricing
View Details
CK-7 Polyclonal Antibody
RD70175A-01 20μL

CK-7 Polyclonal Antibody

Sign In for Pricing
View Details
CK-7 Polyclonal Antibody
RD70175A-02 60μL

CK-7 Polyclonal Antibody

Sign In for Pricing
View Details
CK-7 Polyclonal Antibody
RD70175A-03 120μL

CK-7 Polyclonal Antibody

Sign In for Pricing
View Details
CK-7 Polyclonal Antibody
RD70175A-04 200μL

CK-7 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Rat BRAK protein (Cxcl14) (Active)
CSB-AP001481RA-01 5 µg

Recombinant Rat BRAK protein (Cxcl14) (Active)

Sign In for Pricing
View Details