PPP1R12A Peptide - middle region
PPP1R12A Peptide - middle region
Product Specifications
Product Name Alternative
MBS, M130, MYPT1
UniProt
O14974
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PPP1R12A Rabbit Polyclonal Antibody (orb589680) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001137357.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RRPREKRRSTGVSFWTQDSDENEQEQQSDTEEGSNKKETQTDSISRYETS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470385-500 1x 500 µL
CD3e (Rabbit PAb), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![PE/Elab Fluor® 594 Rat IgM, κ Isotype Control[RTK2118]](https://cdn.genprice.uk/products/763/68dd149f061270361e7d049d/imageurl/e-ab-f09772p.webp)
E-AB-F09772P-01 20 Tests
PE/Elab Fluor® 594 Rat IgM, κ Isotype Control[RTK2118]
Sign In for Pricing
View Details E-AB-F09772P-02 100 Tests
PE/Elab Fluor® 594 Rat IgM, κ Isotype Control[RTK2118]
Sign In for Pricing
View Details E-AB-F09772P-03 2x 100 Tests
PE/Elab Fluor® 594 Rat IgM, κ Isotype Control[RTK2118]
Sign In for Pricing
View Details