Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASIP Peptide - middle region

ASIP Peptide - middle region

Product Specifications

Product Name Alternative

ASP, AGSW, AGTI, AGTIL, SHEP9

UniProt

P42127

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ASIP Rabbit Polyclonal Antibody (orb589717) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001663.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CFFTANSHLPPEEKLRDDRSLRSNSSVNLLDVPSVSIVALNKKSKQIGRK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Apol11b shRNA (UAS) - Lentiviral mouse Apol11b shRNA (UAS, RFP) (100)
GTR15265824 1 Vial

Lentiviral mouse Apol11b shRNA (UAS) - Lentiviral mouse Apol11b shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Human DPYSL3 (Dihydropyrimidinase Like Protein 3) ValidElisa Kit
EK342085 96 Well

Human DPYSL3 (Dihydropyrimidinase Like Protein 3) ValidElisa Kit

Sign In for Pricing
View Details
Recombinant Dinoroseobacter shibae Phosphoribosyl-ATP pyrophosphatase (hisE)
MBS1252737-01 0.02 mg (E-Coli)

Recombinant Dinoroseobacter shibae Phosphoribosyl-ATP pyrophosphatase (hisE)

Sign In for Pricing
View Details
Recombinant Dinoroseobacter shibae Phosphoribosyl-ATP pyrophosphatase (hisE)
MBS1252737-02 0.1 mg (E-Coli)

Recombinant Dinoroseobacter shibae Phosphoribosyl-ATP pyrophosphatase (hisE)

Sign In for Pricing
View Details
Recombinant Dinoroseobacter shibae Phosphoribosyl-ATP pyrophosphatase (hisE)
MBS1252737-03 0.02 mg (Yeast)

Recombinant Dinoroseobacter shibae Phosphoribosyl-ATP pyrophosphatase (hisE)

Sign In for Pricing
View Details
Recombinant Dinoroseobacter shibae Phosphoribosyl-ATP pyrophosphatase (hisE)
MBS1252737-04 0.1 mg (Yeast)

Recombinant Dinoroseobacter shibae Phosphoribosyl-ATP pyrophosphatase (hisE)

Sign In for Pricing
View Details