Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASIP Peptide - middle region

ASIP Peptide - middle region

Product Specifications

Product Name Alternative

ASP, AGSW, AGTI, AGTIL, SHEP9

UniProt

P42127

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ASIP Rabbit Polyclonal Antibody (orb589717) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001663.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CFFTANSHLPPEEKLRDDRSLRSNSSVNLLDVPSVSIVALNKKSKQIGRK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APC-Linked Polyclonal Antibody to Myeloperoxidase (MPO)
MBS2119673-01 0.1 mL

APC-Linked Polyclonal Antibody to Myeloperoxidase (MPO)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Myeloperoxidase (MPO)
MBS2119673-02 0.2 mL

APC-Linked Polyclonal Antibody to Myeloperoxidase (MPO)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Myeloperoxidase (MPO)
MBS2119673-03 0.5 mL

APC-Linked Polyclonal Antibody to Myeloperoxidase (MPO)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Myeloperoxidase (MPO)
MBS2119673-04 1 mL

APC-Linked Polyclonal Antibody to Myeloperoxidase (MPO)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Myeloperoxidase (MPO)
MBS2119673-05 5 mL

APC-Linked Polyclonal Antibody to Myeloperoxidase (MPO)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Myeloperoxidase (MPO)
MBS2119673-06 5x 5 mL

APC-Linked Polyclonal Antibody to Myeloperoxidase (MPO)

Sign In for Pricing
View Details