Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBM10 Peptide - N-terminal region

RBM10 Peptide - N-terminal region

Product Specifications

Product Name Alternative

S1-1, TARPS, GPATC9, ZRANB5, GPATCH9, DXS8237E

UniProt

P98175

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RBM10 Rabbit Polyclonal Antibody (orb588345) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001191395.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GRYGATDRSQDDGGENRSRDHDYRDMDYRSYPREYGSQEGKHDYDDSSEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse DEFa5 (Defensin Alpha 5, Paneth Cell Specific) CLIA Kit
E-CL-M0254-01 24 Tests

Mouse DEFa5 (Defensin Alpha 5, Paneth Cell Specific) CLIA Kit

Sign In for Pricing
View Details
Mouse DEFa5 (Defensin Alpha 5, Paneth Cell Specific) CLIA Kit
E-CL-M0254-02 48 Tests

Mouse DEFa5 (Defensin Alpha 5, Paneth Cell Specific) CLIA Kit

Sign In for Pricing
View Details
Mouse DEFa5 (Defensin Alpha 5, Paneth Cell Specific) CLIA Kit
E-CL-M0254-03 96 Tests

Mouse DEFa5 (Defensin Alpha 5, Paneth Cell Specific) CLIA Kit

Sign In for Pricing
View Details
Lamin B1 (LMNB1) Rabbit Polyclonal Antibody
AP20660PU-N 100 µg

Lamin B1 (LMNB1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CPA5 (NM_080385) Human Recombinant Protein
TP307397 20 µg

CPA5 (NM_080385) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Human Cystatin D Protein (His Tag)
PKSH033415-01 10 µg

Recombinant Human Cystatin D Protein (His Tag)

Sign In for Pricing
View Details