Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AP3B1 Peptide - middle region

AP3B1 Peptide - middle region

Product Specifications

Product Name Alternative

PE, HPS, HPS2, ADTB3, ADTB3A

UniProt

O00203

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AP3B1 Rabbit Polyclonal Antibody (orb588712) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001258698.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TRYARTQFVSPWKEGDELEDNGKNFYESDDDQKEKTDKKKKPYTMDPDHR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR52N4 Antibody Blocking Peptide
orb1509687 500 µg

OR52N4 Antibody Blocking Peptide

Sign In for Pricing
View Details
Rlf2 Antibody
orb855832 2 mg

Rlf2 Antibody

Sign In for Pricing
View Details
PRRC2C Knockout Huh-7 Cell Line
ARG0448 1 Million

PRRC2C Knockout Huh-7 Cell Line

Sign In for Pricing
View Details
MED9 Rabbit Polyclonal Antibody (AP)
orb956026 100 µL

MED9 Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details
ANQ-11125 TFA
T75861-01 5 mg

ANQ-11125 TFA

Sign In for Pricing
View Details
ANQ-11125 TFA
T75861-02 50 mg

ANQ-11125 TFA

Sign In for Pricing
View Details