TAGLN2 Peptide - middle region
TAGLN2 Peptide - middle region
Product Specifications
Product Name Alternative
HA1756
UniProt
P37802
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TAGLN2 Rabbit Polyclonal Antibody (orb589403) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001264152.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: CVQRTLMNLGGLAVARDDGLFSGDPNWFPKKSKENPRNFSDNQLQEGKNV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
A08267-4-Fluoro647 100 µg/Vial
Anti-Calponin 3/CNN3 Antibody Picoband® Fluoro647 Conjugated
Sign In for Pricing
View Details 
GTR15120840 1 Vial
Lentiviral human C2orf78 shRNA (UAS) - Lentiviral human C2orf78 shRNA (UAS, RFP) (100)
Sign In for Pricing
View Details 