MC3R Peptide - middle region
MC3R Peptide - middle region
Product Specifications
Product Name Alternative
MC3, OB20, OQTL, BMIQ9, MC3-R
UniProt
P41968
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MC3R Rabbit Polyclonal Antibody (orb589406) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_063941.3
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: CCLPSVQPTLPNGSEHLQAPFFSNQSSSAFCEQVFIKPEVFLSLGIVSLL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6487325-01 0.1 mL
Mcl 1 (Myeloid Cell Leukemia 1, MCL1, Mcl-1, Bcl 2 Related Protein EAT/Mcl1, Bcl-2-like Protein 3, BCL2L3, Bcl2-L-3, EAT, Induced Myeloid Leukemia Cell Differentiation Protein, Mcl1/EAT, MCL1L, MCL1S, MGC1839, MGC104264, Myeloid Cell Leukemia Sequence 1,
Sign In for Pricing
View Details MBS6487325-02 5x 0.1 mL
Mcl 1 (Myeloid Cell Leukemia 1, MCL1, Mcl-1, Bcl 2 Related Protein EAT/Mcl1, Bcl-2-like Protein 3, BCL2L3, Bcl2-L-3, EAT, Induced Myeloid Leukemia Cell Differentiation Protein, Mcl1/EAT, MCL1L, MCL1S, MGC1839, MGC104264, Myeloid Cell Leukemia Sequence 1,
Sign In for Pricing
View Details 
MBS6441298-01 0.1 mL
TP53 (Tumor Protein p53, Tumor Suppressor p53, TRP53, Cellular Tumor Antigen p53, Phosphoprotein p53, Antigen NY-CO-13, LFS1) (MaxLight 550)
Sign In for Pricing
View Details MBS6441298-02 5x 0.1 mL
TP53 (Tumor Protein p53, Tumor Suppressor p53, TRP53, Cellular Tumor Antigen p53, Phosphoprotein p53, Antigen NY-CO-13, LFS1) (MaxLight 550)
Sign In for Pricing
View Details TRV-0032540-01 20 µL
Monoclonal Antibody to Glial Fibrillary Acidic Protein (GFAP)
Sign In for Pricing
View Details TRV-0032540-02 100 µL
Monoclonal Antibody to Glial Fibrillary Acidic Protein (GFAP)
Sign In for Pricing
View Details