Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MC3R Peptide - middle region

MC3R Peptide - middle region

Product Specifications

Product Name Alternative

MC3, OB20, OQTL, BMIQ9, MC3-R

UniProt

P41968

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MC3R Rabbit Polyclonal Antibody (orb589406) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_063941.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CCLPSVQPTLPNGSEHLQAPFFSNQSSSAFCEQVFIKPEVFLSLGIVSLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monoclonal Antibody to Insulin (INS)
TRV-0033645-01 20 µL

Monoclonal Antibody to Insulin (INS)

Sign In for Pricing
View Details
Monoclonal Antibody to Insulin (INS)
TRV-0033645-02 100 µL

Monoclonal Antibody to Insulin (INS)

Sign In for Pricing
View Details
Monoclonal Antibody to Insulin (INS)
TRV-0033645-03 200 µL

Monoclonal Antibody to Insulin (INS)

Sign In for Pricing
View Details
Monoclonal Antibody to Insulin (INS)
TRV-0033645-04 1 mL

Monoclonal Antibody to Insulin (INS)

Sign In for Pricing
View Details
Membralin Rabbit pAb, Pacific Blue conjugated
orb2869264 100 µL

Membralin Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details
Rat Tmem115 Pre-designed siRNA Set B
SI214674B 1 Each

Rat Tmem115 Pre-designed siRNA Set B

Sign In for Pricing
View Details