Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LPCAT4 Peptide - middle region

LPCAT4 Peptide - middle region

Product Specifications

Product Name Alternative

AYTL3, AGPAT7, LPEAT2, LPAAT-eta

UniProt

Q643R3

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LPCAT4 Rabbit Polyclonal Antibody (orb589412) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_705841.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VQPVLIRYPNSLDTTSWAWRGPGVLKVLWLTASQPCSIVDVEFLPVYHPS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD91 Blocking Peptide
orb706317-01 1 mg

CD91 Blocking Peptide

Sign In for Pricing
View Details
CD91 Blocking Peptide
orb706317-02 5 mg

CD91 Blocking Peptide

Sign In for Pricing
View Details
KRT87P Peptide - middle region
orb2004616 100 µg

KRT87P Peptide - middle region

Sign In for Pricing
View Details
TMC5, ID (TMC5, Transmembrane channel-like protein 5) (MaxLight 650)
MBS6356149-01 0.1 mL

TMC5, ID (TMC5, Transmembrane channel-like protein 5) (MaxLight 650)

Sign In for Pricing
View Details
TMC5, ID (TMC5, Transmembrane channel-like protein 5) (MaxLight 650)
MBS6356149-02 5x 0.1 mL

TMC5, ID (TMC5, Transmembrane channel-like protein 5) (MaxLight 650)

Sign In for Pricing
View Details
Recombinant Mouse Complement component receptor 1-like protein (Cr1l), partial
orb1646934-01 20 µg

Recombinant Mouse Complement component receptor 1-like protein (Cr1l), partial

Sign In for Pricing
View Details