FASTK Peptide - C-terminal region
FASTK Peptide - C-terminal region
Product Specifications
Product Name Alternative
FAST
UniProt
Q14296
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with FASTK Rabbit Polyclonal Antibody (orb589512) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001245390.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: FCRDGRVLLGSRALRERHLGLMGYQLLPLPFEELESQRGLPQLKSYLRQK
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1353312-01 0.02 mg (E-Coli)
Recombinant Human Secretoglobin family 1D member 4 (SCGB1D4)
Sign In for Pricing
View Details MBS1353312-02 0.1 mg (E-Coli)
Recombinant Human Secretoglobin family 1D member 4 (SCGB1D4)
Sign In for Pricing
View Details MBS1353312-03 0.02 mg (Yeast)
Recombinant Human Secretoglobin family 1D member 4 (SCGB1D4)
Sign In for Pricing
View Details MBS1353312-04 0.1 mg (Yeast)
Recombinant Human Secretoglobin family 1D member 4 (SCGB1D4)
Sign In for Pricing
View Details MBS1353312-05 0.02 mg (Baculovirus)
Recombinant Human Secretoglobin family 1D member 4 (SCGB1D4)
Sign In for Pricing
View Details