SCRN3 Peptide - middle region
SCRN3 Peptide - middle region
Product Specifications
Product Name Alternative
SES3
UniProt
Q12765
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SCRN3 Rabbit Polyclonal Antibody (orb589515) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001180457.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: HDNLGERLKCTYIEIDQVPETYAVVLSRPAWLWGAEMGANEHGVCIGNEA
More Discoveries
Explore Other Products
Browse additional items from our catalog
I7661-05-ML405 100 µL
Insulin-Like Growth Factor I (IGF1, Somatomedin C) (MaxLight 405) discontinued
Sign In for Pricing
View Details 
E-EL-R2508 96 Tests
ELISA kit for Rat ADORA2a (Adenosine A2a Receptor)
Sign In for Pricing
View Details 
![BLNK Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2B2]](https://cdn.genprice.uk/products/937/68dd1b80061270361ea1e34a/imageurl/ta808522bm.webp)
TA808522BM 100 µL
BLNK Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2B2]
Sign In for Pricing
View Details