SCRN3 Peptide - middle region
SCRN3 Peptide - middle region
Product Specifications
Product Name Alternative
SES3
UniProt
Q12765
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SCRN3 Rabbit Polyclonal Antibody (orb589515) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001180457.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: HDNLGERLKCTYIEIDQVPETYAVVLSRPAWLWGAEMGANEHGVCIGNEA
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS9438869-01 0.1 mL (Biotin)
PI3 Kinase p85/p55 (Ab-467/199) Conjugated Antibody
Sign In for Pricing
View Details MBS9438869-02 0.1 mL (AF350)
PI3 Kinase p85/p55 (Ab-467/199) Conjugated Antibody
Sign In for Pricing
View Details MBS9438869-03 0.1 mL (AF405)
PI3 Kinase p85/p55 (Ab-467/199) Conjugated Antibody
Sign In for Pricing
View Details