Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDC14B Peptide - N-terminal region

CDC14B Peptide - N-terminal region

Product Specifications

Product Name Alternative

CDC14B3, Cdc14B1, Cdc14B2, hCDC14B

UniProt

O60729

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CDC14B Rabbit Polyclonal Antibody (orb589524) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001070649.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RCSSTSPGVKKIRSSTQQDPRRRDPQDDVYLDITDRLCFAILYSRPKSAS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DHODH discontinued
535548-01 30ul

DHODH discontinued

Sign In for Pricing
View Details
DHODH discontinued
535548-02 100 µL

DHODH discontinued

Sign In for Pricing
View Details
Inosine ribo 25 nmol scale
27-6421-25 1 Each

Inosine ribo 25 nmol scale

Sign In for Pricing
View Details
Recombinant Rat Tumor necrosis factor receptor superfamily member 1B (Tnfrsf1b), partial
MBS1410630-01 0.5 mg (E-Coli)

Recombinant Rat Tumor necrosis factor receptor superfamily member 1B (Tnfrsf1b), partial

Sign In for Pricing
View Details
Recombinant Rat Tumor necrosis factor receptor superfamily member 1B (Tnfrsf1b), partial
MBS1410630-02 0.05 mg (Baculovirus)

Recombinant Rat Tumor necrosis factor receptor superfamily member 1B (Tnfrsf1b), partial

Sign In for Pricing
View Details
Recombinant Rat Tumor necrosis factor receptor superfamily member 1B (Tnfrsf1b), partial
MBS1410630-03 0.5 mg (Yeast)

Recombinant Rat Tumor necrosis factor receptor superfamily member 1B (Tnfrsf1b), partial

Sign In for Pricing
View Details