Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDC14B Peptide - N-terminal region

CDC14B Peptide - N-terminal region

Product Specifications

Product Name Alternative

CDC14B3, Cdc14B1, Cdc14B2, hCDC14B

UniProt

O60729

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CDC14B Rabbit Polyclonal Antibody (orb589524) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001070649.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RCSSTSPGVKKIRSSTQQDPRRRDPQDDVYLDITDRLCFAILYSRPKSAS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat CD19 MAb (Clone 771404)
MAB7489-SP 25 µg

Rat CD19 MAb (Clone 771404)

Sign In for Pricing
View Details
Hsa-miR-595 agomir
HY-R01827A-01 5 nmol

Hsa-miR-595 agomir

Sign In for Pricing
View Details
Hsa-miR-595 agomir
HY-R01827A-02 20 nmol

Hsa-miR-595 agomir

Sign In for Pricing
View Details
Mouse CD161/NK1.1 MAb (Clone PK136)
MAB76141-100 100 µg

Mouse CD161/NK1.1 MAb (Clone PK136)

Sign In for Pricing
View Details
N, N-Bis (2-hydroxyethyl) -2-aminoethanesulfonic acid (BES)
GC208027-25g 25 g

N, N-Bis (2-hydroxyethyl) -2-aminoethanesulfonic acid (BES)

Sign In for Pricing
View Details
DARS antibody
orb255302-01 50 μL

DARS antibody

Sign In for Pricing
View Details