Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNF Peptide - N-terminal region

TNF Peptide - N-terminal region

Product Specifications

Product Name Alternative

DIF, TNFA, TNFSF2, TNLG1F, TNF-alpha

UniProt

P01375

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TNF Rabbit Polyclonal Antibody (orb2284538) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_000585.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: STESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD55 (NM_001300902) Human Tagged ORF Clone
RG238266 10 µg

CD55 (NM_001300902) Human Tagged ORF Clone

Sign In for Pricing
View Details
Sox12 Mouse Gene Knockout Kit (CRISPR)
KN516489 1 Kit

Sox12 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
LRAT Antibody
8C10219-AAT 50 µg

LRAT Antibody

Sign In for Pricing
View Details
NUDT19 Polyclonal Antibody
E-AB-19451-01 20 µL

NUDT19 Polyclonal Antibody

Sign In for Pricing
View Details
NUDT19 Polyclonal Antibody
E-AB-19451-02 60 µL

NUDT19 Polyclonal Antibody

Sign In for Pricing
View Details
NUDT19 Polyclonal Antibody
E-AB-19451-03 120 µL

NUDT19 Polyclonal Antibody

Sign In for Pricing
View Details