OMD Peptide - C-terminal region
OMD Peptide - C-terminal region
Product Specifications
Product Name Alternative
OSAD, SLRR2C
UniProt
Q99983
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with OMD Rabbit Polyclonal Antibody (orb589669) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_005005.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: QTIQLKTQVFRRFPDDDDESEDHDDPDNAHESPEQEGAEGHFDLHYYENQ
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1883827-01 0.01 mg
Human PK2L1-Strep full length protein-synthetic nanodisc
Sign In for Pricing
View Details 
MBS1883827-02 0.05 mg
Human PK2L1-Strep full length protein-synthetic nanodisc
Sign In for Pricing
View Details 
MBS1883827-03 0.1 mg
Human PK2L1-Strep full length protein-synthetic nanodisc
Sign In for Pricing
View Details TL308947V 500 µL Each
TRBP (TARBP2) Human shRNA Lentiviral Particle (Locus ID 6895)
Sign In for Pricing
View Details