Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MCHR1 Peptide - C-terminal region

MCHR1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

SLC1, GPR24, MCH1R, SLC-1, MCH-1R

UniProt

Q5IFH6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MCHR1 Rabbit Polyclonal Antibody (orb589671) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_005288.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human FNIP1 activation kit by CRISPRa
GA114346 1 Kit

Human FNIP1 activation kit by CRISPRa

Sign In for Pricing
View Details
CABYR (NM_012189) Human Recombinant Protein
TP314772M 100 µg

CABYR (NM_012189) Human Recombinant Protein

Sign In for Pricing
View Details
Acetylthiocholine Iodide
TRC-A164610-5G 5 g

Acetylthiocholine Iodide

Sign In for Pricing
View Details
HGS (NM_004712) Human Over-expression Lysate
LY401488 100 µg

HGS (NM_004712) Human Over-expression Lysate

Sign In for Pricing
View Details
Involucrin (Squamous Cell Terminal Differentiation Marker) (IVRN/2113R), CF740 conjugate, 0.1mg/mL
BNC742113-100 1x 100 µL

Involucrin (Squamous Cell Terminal Differentiation Marker) (IVRN/2113R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ANKRD46 Human qPCR Primer Pair (NM_198401)
HP219310 200 Reactions

ANKRD46 Human qPCR Primer Pair (NM_198401)

Sign In for Pricing
View Details