Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MCHR1 Peptide - C-terminal region

MCHR1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

SLC1, GPR24, MCH1R, SLC-1, MCH-1R

UniProt

Q5IFH6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MCHR1 Rabbit Polyclonal Antibody (orb589671) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_005288.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Apovincaminic Acid Ethyl Ester N-Oxide
TRC-A729255-25MG 25 mg

Apovincaminic Acid Ethyl Ester N-Oxide

Sign In for Pricing
View Details
Mouse Mup4 activation kit by CRISPRa
GA202768 1 Kit

Mouse Mup4 activation kit by CRISPRa

Sign In for Pricing
View Details
DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/1484), CF640R conjugate, 0.1mg/mL
BNC401484-100 1x 100 µL

DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/1484), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Adgre1 activation kit by CRISPRa
GA201235 1 Kit

Mouse Adgre1 activation kit by CRISPRa

Sign In for Pricing
View Details
Biotin (Vitamin B7 or Vitamin H) (BTN/2032R), CF568 conjugate, 0.1mg/mL
BNC682032-500 1x 500 µL

Biotin (Vitamin B7 or Vitamin H) (BTN/2032R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS651148 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details