Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

XRCC2 Peptide - middle region

XRCC2 Peptide - middle region

Product Specifications

UniProt

O43543

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with XRCC2 Rabbit Polyclonal Antibody (orb589685) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_005422.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VNDYRLVLFATTQTIMQKASSSSEEPSHASRRLCDVDIDYRPYLCKAWQQ

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZDHHC20 discontinued
532119-01 20 µL

ZDHHC20 discontinued

Sign In for Pricing
View Details
ZDHHC20 discontinued
532119-02 100 µL

ZDHHC20 discontinued

Sign In for Pricing
View Details
GINS3 3'UTR Lenti-reporter-Luc Vector
21521081 1.0 µg

GINS3 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
B020004J07RIK Adenovirus (Mouse)
12914054 1.0 mL

B020004J07RIK Adenovirus (Mouse)

Sign In for Pricing
View Details
Human CYLC2 activation kit by CRISPRa
GA101088 1 Kit

Human CYLC2 activation kit by CRISPRa

Sign In for Pricing
View Details
Glutaredoxin 1 (GLRX) Rabbit Polyclonal Antibody
TA332605 100 µL

Glutaredoxin 1 (GLRX) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details