Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DCPS Peptide - middle region

DCPS Peptide - middle region

Product Specifications

Product Name Alternative

ARS, DCS1, HSL1, HINT5, HINT-5, HSPC015

UniProt

Q96C86

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DCPS Rabbit Polyclonal Antibody (orb589691) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_054745.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GNGTCAPVRLPFSGFRLQKVLRESARDKIIFLHGKVNEASGDGDGEDAVV

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Il23a/Interleukin-23 subunit alpha ELISA Kit
EK00311E 96 Tests

Mouse Il23a/Interleukin-23 subunit alpha ELISA Kit

Sign In for Pricing
View Details
Recombinant Neostylopyga rhombifolia Pyrokinin-6
MBS1196162-01 0.05 mg (E-Coli)

Recombinant Neostylopyga rhombifolia Pyrokinin-6

Sign In for Pricing
View Details
Recombinant Neostylopyga rhombifolia Pyrokinin-6
MBS1196162-02 0.2 mg (E-Coli)

Recombinant Neostylopyga rhombifolia Pyrokinin-6

Sign In for Pricing
View Details
Recombinant Neostylopyga rhombifolia Pyrokinin-6
MBS1196162-03 0.5 mg (E-Coli)

Recombinant Neostylopyga rhombifolia Pyrokinin-6

Sign In for Pricing
View Details
Recombinant Neostylopyga rhombifolia Pyrokinin-6
MBS1196162-04 0.05 mg (Yeast)

Recombinant Neostylopyga rhombifolia Pyrokinin-6

Sign In for Pricing
View Details
Recombinant Neostylopyga rhombifolia Pyrokinin-6
MBS1196162-05 0.05 mg (Baculovirus)

Recombinant Neostylopyga rhombifolia Pyrokinin-6

Sign In for Pricing
View Details