SEMA4D Peptide - middle region
SEMA4D Peptide - middle region
Product Specifications
Product Name Alternative
CD100, SEMAJ, coll-4, C9orf164, M-sema-G
UniProt
Q92854
Field of Research
Neuroscience
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SEMA4D Rabbit Polyclonal Antibody (orb589699) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001135759.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ISRNSSHSPLRTEYAIPWLNEPSFVFADVIRKSPDSPDGEDDRVYFFFTE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6279829-01 0.2 mL
C2orf49, NT (C2orf49, Ashwin) (Azide free) (HRP)
Sign In for Pricing
View Details MBS6279829-02 5x 0.2 mL
C2orf49, NT (C2orf49, Ashwin) (Azide free) (HRP)
Sign In for Pricing
View Details 
LS768206-20ug 20 µg
PRCD (NM_001077620) Human Over-expression Lysate
Sign In for Pricing
View Details