Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRG4 Peptide - N-terminal region

PRG4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MSF, SZP, CACP, HAPO, JCAP

UniProt

Q92954

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRG4 Rabbit Polyclonal Antibody (orb589712) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001121180.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SKNSAANRELQKKLKVKDNKKNRTKKKPTPKPPVVDEAGSGLDNGDFKVT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine DNA Damage Inducible Transcript 3 ELISA kit
GTR10399819 96 Well

Bovine DNA Damage Inducible Transcript 3 ELISA kit

Sign In for Pricing
View Details
IFluor® 450 Anti-human CD27 Antibody *O323*
10271041-AAT 500 Tests

IFluor® 450 Anti-human CD27 Antibody *O323*

Sign In for Pricing
View Details
C-Met (Hepatocyte Growth Factor Receptor, Scatter Factor Receptor, HGFR, SFR) (MaxLight 550) discontinued
M3007-15-ML550 100 µL

C-Met (Hepatocyte Growth Factor Receptor, Scatter Factor Receptor, HGFR, SFR) (MaxLight 550) discontinued

Sign In for Pricing
View Details
MAP2 Conjugated Antibody
MBS9442446-01 0.1 mL (Biotin)

MAP2 Conjugated Antibody

Sign In for Pricing
View Details
MAP2 Conjugated Antibody
MBS9442446-02 0.1 mL (AF350)

MAP2 Conjugated Antibody

Sign In for Pricing
View Details
MAP2 Conjugated Antibody
MBS9442446-03 0.1 mL (AF405)

MAP2 Conjugated Antibody

Sign In for Pricing
View Details