Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRG4 Peptide - N-terminal region

PRG4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MSF, SZP, CACP, HAPO, JCAP

UniProt

Q92954

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRG4 Rabbit Polyclonal Antibody (orb589712) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001121180.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SKNSAANRELQKKLKVKDNKKNRTKKKPTPKPPVVDEAGSGLDNGDFKVT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Alpha Fetoprotein (AFP) Antibody (Detection Ab)
abx019292 1 mg

Alpha Fetoprotein (AFP) Antibody (Detection Ab)

Sign In for Pricing
View Details
Goat 5-Methyltetrahydrofolate Homocysteine Methyltransferase ELISA Kit
MBS105473 Inquire

Goat 5-Methyltetrahydrofolate Homocysteine Methyltransferase ELISA Kit

Sign In for Pricing
View Details
Nolz-1 CRISPR Activation Plasmid (m2)
sc-432325-ACT-2 20 µg

Nolz-1 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
Rat LEP Matched Antibody Pair Set [ABP-S-03846]
ABP-S-03846 5 Plates

Rat LEP Matched Antibody Pair Set [ABP-S-03846]

Sign In for Pricing
View Details
Recombinant human MDL-1/CLEC5A protein
ATGP2946-250 250 µg

Recombinant human MDL-1/CLEC5A protein

Sign In for Pricing
View Details
Formyl-Histone H2B type 2E (LyS121) Recombinant Antibody, APC Conjugated
bsm-62332R-APC-TR 20 µL

Formyl-Histone H2B type 2E (LyS121) Recombinant Antibody, APC Conjugated

Sign In for Pricing
View Details