Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNQ5 Peptide - C-terminal region

KCNQ5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Kv7.5

UniProt

Q9NR82

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KCNQ5 Rabbit Polyclonal Antibody (orb575435) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_062816

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ELNIQLSGSESSGSRGSQDFYPKWRESKLFITDEEVGPEETETDTFDAAP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ANGPTL6/Angiopoietin-related protein 6 ELISA Kit
E45K00244 96 Tests

Human ANGPTL6/Angiopoietin-related protein 6 ELISA Kit

Sign In for Pricing
View Details
GAB2 Antibody (YA7091, Mouse)
HY-P87403 1 Each

GAB2 Antibody (YA7091, Mouse)

Sign In for Pricing
View Details
BRP44 (MPC2) (NM_001143674) Human Tagged Lenti ORF Clone
RC227111L4 10 µg

BRP44 (MPC2) (NM_001143674) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Camel Up-Regulated During Skeletal Muscle Growth Protein 5 (USMG5) ELISA Kit
MBS9932745 Inquire

Camel Up-Regulated During Skeletal Muscle Growth Protein 5 (USMG5) ELISA Kit

Sign In for Pricing
View Details
GCAP2 (6D433) : m-IgG Fc BP-HRP Bundle
sc-539350 1 Kit

GCAP2 (6D433) : m-IgG Fc BP-HRP Bundle

Sign In for Pricing
View Details
SOLIDEX®-ISOEx Untouched Mouse Naïve CD8+ T Cell Isolation Kit (Column-free)
GM-mNaive-CD8-T-Cell-iso-kit-CF-50T 50 Tests

SOLIDEX®-ISOEx Untouched Mouse Naïve CD8+ T Cell Isolation Kit (Column-free)

Sign In for Pricing
View Details