Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNQ5 Peptide - C-terminal region

KCNQ5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Kv7.5

UniProt

Q9NR82

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KCNQ5 Rabbit Polyclonal Antibody (orb575435) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_062816

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ELNIQLSGSESSGSRGSQDFYPKWRESKLFITDEEVGPEETETDTFDAAP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Olfr678 (NM_146758) AAV Particle
MR212961A1V 250 µL

Mouse Olfr678 (NM_146758) AAV Particle

Sign In for Pricing
View Details
AMOTL2, ID (Leman Coiled-coil Protein, LCCP, Angiomotin-like Protein 2, KIAA0989) (PE) discontinued
A1460-50-PE 200 µL

AMOTL2, ID (Leman Coiled-coil Protein, LCCP, Angiomotin-like Protein 2, KIAA0989) (PE) discontinued

Sign In for Pricing
View Details
Rabbit Polyclonal FABP6 Antibody
NBP1-32482 100 µL

Rabbit Polyclonal FABP6 Antibody

Sign In for Pricing
View Details
PARP7 Antibody
MBS9629651-01 0.1 mL

PARP7 Antibody

Sign In for Pricing
View Details
PARP7 Antibody
MBS9629651-02 0.2 mL

PARP7 Antibody

Sign In for Pricing
View Details
PARP7 Antibody
MBS9629651-03 5x 0.2 mL

PARP7 Antibody

Sign In for Pricing
View Details