Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADCY10 Peptide - N-terminal region

ADCY10 Peptide - N-terminal region

Product Specifications

Product Name Alternative

SAC, HCA2, SACI, Sacy, hsAC, HEL-S-7a

UniProt

Q96PN6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ADCY10 Rabbit Polyclonal Antibody (orb580062) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_060887

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FTAMTEKFSSAMYMDRGAEQLVEILNYHISAIVEKVLIFGGDILKFAGDA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal GTF2H2 Antibody
NBP2-87537 100 µL

Rabbit Polyclonal GTF2H2 Antibody

Sign In for Pricing
View Details
PKC alpha Recombinant Rabbit mAb, PE-Cy5 conjugated
orb3163969 100 µL

PKC alpha Recombinant Rabbit mAb, PE-Cy5 conjugated

Sign In for Pricing
View Details
Ankrd34a siRNA Oligos set (Rat)
11989176 3x 5 nmol

Ankrd34a siRNA Oligos set (Rat)

Sign In for Pricing
View Details
ZNF277 Double Nickase Plasmid (h)
sc-411583-NIC 20 µg

ZNF277 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
Polyclonal Antibody to Tissue Inhibitors Of Metalloproteinase 2 (TIMP2)
MBS2003584-01 0.1 mL

Polyclonal Antibody to Tissue Inhibitors Of Metalloproteinase 2 (TIMP2)

Sign In for Pricing
View Details
Polyclonal Antibody to Tissue Inhibitors Of Metalloproteinase 2 (TIMP2)
MBS2003584-02 0.2 mL

Polyclonal Antibody to Tissue Inhibitors Of Metalloproteinase 2 (TIMP2)

Sign In for Pricing
View Details