Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADCY10 Peptide - N-terminal region

ADCY10 Peptide - N-terminal region

Product Specifications

Product Name Alternative

SAC, HCA2, SACI, Sacy, hsAC, HEL-S-7a

UniProt

Q96PN6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ADCY10 Rabbit Polyclonal Antibody (orb580062) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_060887

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FTAMTEKFSSAMYMDRGAEQLVEILNYHISAIVEKVLIFGGDILKFAGDA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal HECTD4 Antibody
NBP2-30719 0.1 mL

Rabbit Polyclonal HECTD4 Antibody

Sign In for Pricing
View Details
CCDC167 Knockout HT29 Polyclonal Cells
ARG42974 1 Million

CCDC167 Knockout HT29 Polyclonal Cells

Sign In for Pricing
View Details
Mouse Anti-Chicken IgY
orb869549-01 1 mg

Mouse Anti-Chicken IgY

Sign In for Pricing
View Details
Mouse Anti-Chicken IgY
orb869549-02 10 mg

Mouse Anti-Chicken IgY

Sign In for Pricing
View Details
CDCP1 antibody
20R-2729 50 ug

CDCP1 antibody

Sign In for Pricing
View Details
Human Metallothionein 1 (MT1) CLIA Kit
abx492430-01 96 Tests

Human Metallothionein 1 (MT1) CLIA Kit

Sign In for Pricing
View Details