SEMA6C Peptide - C-terminal region
SEMA6C Peptide - C-terminal region
Product Specifications
Product Name Alternative
SEMAY, m-SemaY, m-SemaY2
UniProt
Q9H3T2
Field of Research
Neuroscience
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SEMA6C Rabbit Polyclonal Antibody (orb585273) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001171532.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KDGDAVQTPQLYTTFLPPPEGVPPPELACLPTPESTPELPVKHLRAAGDP
More Discoveries
Explore Other Products
Browse additional items from our catalog
112313 900 Pack (36 Label (s) x 25 Card)
WM-91-PK Adhesive-backed Markers
Sign In for Pricing
View Details 
TL302684V 500 µL Each
PAPP A2 (PAPPA2) Human shRNA Lentiviral Particle (Locus ID 60676)
Sign In for Pricing
View Details H1830-82 50 µg
Heat Shock Protein 60, Recombinant, Rat (HSP60, GroEL, Chaperonin 60, cpn60)
Sign In for Pricing
View Details