FANCI Peptide - C-terminal region
FANCI Peptide - C-terminal region
Product Specifications
Product Name Alternative
KIAA1794
UniProt
Q9NVI1
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with FANCI Rabbit Polyclonal Antibody (orb588114) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001106849.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: MQHMKLSTSRDFKIKGNILDMVLREDGEDENEEGTASEHGGQNKEPAKKK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680883-100 1x 100 µL
PSA (Prostate Specific Antigen) (A67-B/E3), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401492-500 1x 500 µL
PAX8 (Renal Cell Marker) (PAX8/1492), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 