FANCI Peptide - C-terminal region
FANCI Peptide - C-terminal region
Product Specifications
Product Name Alternative
KIAA1794
UniProt
Q9NVI1
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with FANCI Rabbit Polyclonal Antibody (orb588114) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001106849.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: MQHMKLSTSRDFKIKGNILDMVLREDGEDENEEGTASEHGGQNKEPAKKK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC880889-500 1x 500 µL
PLAP (Placental Alkaline Phosphatase) (PL8-F6), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
![liver FABP Recombinant Rabbit Monoclonal Antibody [JE10-77]](https://cdn.genprice.uk/products/992/68dd1c90061270361ea82be4/imageurl/ha722321.webp)
HA722321 100 µL
liver FABP Recombinant Rabbit Monoclonal Antibody [JE10-77]
Sign In for Pricing
View Details 
BNC400739-500 1x 500 µL
Mitochondrial Marker (113-1), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 