Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HLTF Peptide - middle region

HLTF Peptide - middle region

Product Specifications

Product Name Alternative

ZBU1, HLTF1, RNF80, HIP116, SNF2L3, HIP116A, SMARCA3

UniProt

Q14527

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HLTF Rabbit Polyclonal Antibody (orb588118) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_003062.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DVLGLLLRLRQICCHTYLLTNAVSSNGPSGNDTPEELRKKLIRKMKLILS

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELP3 Double Nickase Plasmid (h)
sc-409995-NIC 20 µg

ELP3 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
PWWP2B Protein Lysate (Human) with C-Ha Tag
38232031 100 µg

PWWP2B Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Human PLEKHG7 knockdown cell line
ABC-KD11749 1 Vial

Human PLEKHG7 knockdown cell line

Sign In for Pricing
View Details
Benzylamine 99% For Synthesis
00395 02500 2.5 L

Benzylamine 99% For Synthesis

Sign In for Pricing
View Details
ARHGEF6 CRISPR All-in-one AAV vector set (with saCas9)(Human)
12344151 3x 1.0 µg DNA

ARHGEF6 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Mouse IL17RA Protein, His Tag
MBS189259-01 0.01 mg

Mouse IL17RA Protein, His Tag

Sign In for Pricing
View Details