Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SFMBT1 Peptide - middle region

SFMBT1 Peptide - middle region

Product Specifications

Product Name Alternative

RU1, SFMBT, hSFMBT

UniProt

Q9UHJ3

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SFMBT1 Rabbit Polyclonal Antibody (orb327272) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_057413.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NLFGPRMVLDKCSENCSVLTKTKYTHYYGKKKNKRIGRPPGGHSNLACAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Amyloid Beta Reference Antibody (aducanumab)
E24CHA583 100 µg

Anti-Amyloid Beta Reference Antibody (aducanumab)

Sign In for Pricing
View Details
Ledipasvir acetone
S4434-5mg 5 mg

Ledipasvir acetone

Sign In for Pricing
View Details
p16 Polyclonal Antibody
UB-GEN-16172 100 µL

p16 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-CA228/ARMH1 Polyclonal Antibody
PAV5410 100 μL

Rabbit Anti-CA228/ARMH1 Polyclonal Antibody

Sign In for Pricing
View Details
UBCH9 (Ubiquitin-conjugating Enzyme E2 E3, Ubiquitin-protein Ligase E3, Ubiquitin Carrier Protein E3, Ubiquitin-conjugating Enzyme E2-23kD, UbcH9, UBE2E3, UBCE4) (HRP)
MBS6155620-01 0.1 mL

UBCH9 (Ubiquitin-conjugating Enzyme E2 E3, Ubiquitin-protein Ligase E3, Ubiquitin Carrier Protein E3, Ubiquitin-conjugating Enzyme E2-23kD, UbcH9, UBE2E3, UBCE4) (HRP)

Sign In for Pricing
View Details
UBCH9 (Ubiquitin-conjugating Enzyme E2 E3, Ubiquitin-protein Ligase E3, Ubiquitin Carrier Protein E3, Ubiquitin-conjugating Enzyme E2-23kD, UbcH9, UBE2E3, UBCE4) (HRP)
MBS6155620-02 5x 0.1 mL

UBCH9 (Ubiquitin-conjugating Enzyme E2 E3, Ubiquitin-protein Ligase E3, Ubiquitin Carrier Protein E3, Ubiquitin-conjugating Enzyme E2-23kD, UbcH9, UBE2E3, UBCE4) (HRP)

Sign In for Pricing
View Details