Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SFMBT1 Peptide - middle region

SFMBT1 Peptide - middle region

Product Specifications

Product Name Alternative

RU1, SFMBT, hSFMBT

UniProt

Q9UHJ3

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SFMBT1 Rabbit Polyclonal Antibody (orb327272) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_057413.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NLFGPRMVLDKCSENCSVLTKTKYTHYYGKKKNKRIGRPPGGHSNLACAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-Succinyl-5-aminoimidazole-4-carboxamide Ribose 5’-Phosphate
TRC-S688795-0.5MG 0.5 mL

N-Succinyl-5-aminoimidazole-4-carboxamide Ribose 5’-Phosphate

Sign In for Pricing
View Details
OMD Antibody - C-terminal region
MBS3221565-01 0.1 mL

OMD Antibody - C-terminal region

Sign In for Pricing
View Details
OMD Antibody - C-terminal region
MBS3221565-02 5x 0.1 mL

OMD Antibody - C-terminal region

Sign In for Pricing
View Details
CIP29 Recombinant Protein Antigen
NBP1-88084PEP 0.1 mL

CIP29 Recombinant Protein Antigen

Sign In for Pricing
View Details
FST Antibody
MBS7136080-01 0.05 mL

FST Antibody

Sign In for Pricing
View Details
FST Antibody
MBS7136080-02 0.1 mL

FST Antibody

Sign In for Pricing
View Details