CD6 Peptide - C-terminal region
CD6 Peptide - C-terminal region
Product Specifications
Product Name Alternative
TP120
UniProt
P30203
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CD6 Rabbit Polyclonal Antibody (orb589706) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001241679.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SERSSFLEQPPNLELAGTQPAFSAGPPADDSSSTSSGEWYQNFQPPPQPP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
A0882-65C-ML650 100 µL
Adenylate Kinase 1 (Adenylate Kinase Isoenzyme 1, AK 1, AK1, AK-1, Adenylate Kinase Soluble, ATP-AMP Transphosphorylase, Myokinase) (MaxLight 650)
Sign In for Pricing
View Details OM637359-01 100 µL
Phospho-TrkB (Y817) Recombinant Rabbit Monoclonal Antibody Antibody
Sign In for Pricing
View Details OM637359-02 20 µL
Phospho-TrkB (Y817) Recombinant Rabbit Monoclonal Antibody Antibody
Sign In for Pricing
View Details OM637359-03 50 µL
Phospho-TrkB (Y817) Recombinant Rabbit Monoclonal Antibody Antibody
Sign In for Pricing
View Details 
orb2645453-01 0.25 g
Alcohol Togni- (3,5-diMe-PyrazolylCF2CF2) reagent
Sign In for Pricing
View Details