Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD6 Peptide - C-terminal region

CD6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

TP120

UniProt

P30203

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CD6 Rabbit Polyclonal Antibody (orb589706) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001241679.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SERSSFLEQPPNLELAGTQPAFSAGPPADDSSSTSSGEWYQNFQPPPQPP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Deoxy Artemisinin
TRC-D232150-5MG 5 mg

Deoxy Artemisinin

Sign In for Pricing
View Details
Z-Lys(z)-osu
TRC-L488848-500MG 500 mg

Z-Lys(z)-osu

Sign In for Pricing
View Details
Dopexamine Hydrochloride
TRC-D533900-5MG 5 mg

Dopexamine Hydrochloride

Sign In for Pricing
View Details
Sulfur Trioxide Triethylamine Complex
TRC-S789455-25G 25 g

Sulfur Trioxide Triethylamine Complex

Sign In for Pricing
View Details
Recombinant Human FUT8 Protein (aa 68-575, His Tag)
PKSH031148 50 µg

Recombinant Human FUT8 Protein (aa 68-575, His Tag)

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Anti-Human CD38 Antibody[HIT2]
E-AB-F1058P-01 20 Tests

PE/Elab Fluor® 594 Anti-Human CD38 Antibody[HIT2]

Sign In for Pricing
View Details