VAPA Peptide - middle region
VAPA Peptide - middle region
Product Specifications
Product Name Alternative
VAP-A, VAP33, VAP-33, hVAP-33
UniProt
Q9P0L0
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with VAPA Rabbit Polyclonal Antibody (orb589713) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_003565.4
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DELMDSKLRCVFEMPNENDKLNDMEPSKAVPLNASKQDGPMPKPHSVSLN
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![AF/LE Purified Anti-Mouse CD31 Antibody[390]](https://cdn.genprice.uk/products/763/68dd14c4061270361e7d7169/imageurl/e-ab-f11800.webp)