EIF5B Peptide - middle region
EIF5B Peptide - middle region
Product Specifications
Product Name Alternative
IF2
UniProt
O60841
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with EIF5B Rabbit Polyclonal Antibody (orb589854) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_056988.3
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: QSRKGQKKNQKNKPGPNIESGNEDDDASFKIKTVAQKKAEKKERERKKRD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
042521-APC 200 µL
SYNPO, CT (SYNPO, KIAA1029, Synaptopodin) (APC) discontinued
Sign In for Pricing
View Details 
MBS725070-01 48 Well
Mouse Cuticular Active Peptide Factor ELISA Kit
Sign In for Pricing
View Details