EIF5B Peptide - middle region
EIF5B Peptide - middle region
Product Specifications
Product Name Alternative
IF2
UniProt
O60841
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with EIF5B Rabbit Polyclonal Antibody (orb589854) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_056988.3
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: QSRKGQKKNQKNKPGPNIESGNEDDDASFKIKTVAQKKAEKKERERKKRD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15157496 1 Vial
Lentiviral human ATXN3 shRNA (UAS) - Lentiviral human ATXN3 shRNA (UAS, GFP) (25)
Sign In for Pricing
View Details 
M3887-43C-Biotin 100 µL
MHC Class 2, DQ, DR, Polymorphic (MHC Class II) (Biotin) discontinued
Sign In for Pricing
View Details 
A04494-3-FITC 100 µg/Vial
Anti-VEGFB Antibody Picoband® (FITC Conjugate)
Sign In for Pricing
View Details IHUFLT1ARCHISLY100UG 100 µg
FLT1 Active Recombinant Protein C-His Tag Lyophilized 100ug
Sign In for Pricing
View Details