Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHIT1 Peptide - C-terminal region

CHIT1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CHI3, CHIT, CHITD

UniProt

Q13231

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CHIT1 Rabbit Polyclonal Antibody (orb589856) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001243054.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GTPELEVPKPGQPSEPEHGPSPGQDTFCQGKADGLYPNPRERSSFYSCAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human DNAJC25 (NM_001015882) AAV Particle
RC208426A1V 250 µL

Human DNAJC25 (NM_001015882) AAV Particle

Sign In for Pricing
View Details
SET And MYND Domain-Containing Protein 2 (SMYD2) Antibody
abx327293-01 50 µg

SET And MYND Domain-Containing Protein 2 (SMYD2) Antibody

Sign In for Pricing
View Details
SET And MYND Domain-Containing Protein 2 (SMYD2) Antibody
abx327293-02 100 µg

SET And MYND Domain-Containing Protein 2 (SMYD2) Antibody

Sign In for Pricing
View Details
Mouse Monoclonal Frk Antibody (OTI6D2)
NBP1-47761 0.1 mL

Mouse Monoclonal Frk Antibody (OTI6D2)

Sign In for Pricing
View Details
SDR9C7 3'UTR Luciferase Stable Cell Line
TU022810 1.0 mL

SDR9C7 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
CD81 (TAPA-1, Target of anti-Proliferative Antibody-1) (MaxLight 750) discontinued
C2433-12B-ML750 100 µL

CD81 (TAPA-1, Target of anti-Proliferative Antibody-1) (MaxLight 750) discontinued

Sign In for Pricing
View Details