Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHIT1 Peptide - C-terminal region

CHIT1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CHI3, CHIT, CHITD

UniProt

Q13231

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CHIT1 Rabbit Polyclonal Antibody (orb589856) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001243054.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GTPELEVPKPGQPSEPEHGPSPGQDTFCQGKADGLYPNPRERSSFYSCAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ergic1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
19419114 3x 1.0 µg

Ergic1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
POLYART CHARTS, The Lymphatic System in Human
4060300/1 1 Each

POLYART CHARTS, The Lymphatic System in Human

Sign In for Pricing
View Details
Dopey-2 shRNA (h) Lentiviral Particles
sc-91467-V 200 µL

Dopey-2 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
Recombinant Human KCNIP3 Protein, N-His
orb2834666-01 20 µg

Recombinant Human KCNIP3 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human KCNIP3 Protein, N-His
orb2834666-02 50 µg

Recombinant Human KCNIP3 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human KCNIP3 Protein, N-His
orb2834666-03 100 µg

Recombinant Human KCNIP3 Protein, N-His

Sign In for Pricing
View Details