Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GYS1 Peptide - C-terminal region

GYS1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GSY, GYS

UniProt

P13807

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GYS1 Rabbit Polyclonal Antibody (orb589861) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001155059.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FTYEPNEADAAQGYRYPRPASVPPSPSLSRHSSPHQSEDEEDPRNGPLEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lung Tissue Slide (Tumor)
MBS154231-01 4 um

Lung Tissue Slide (Tumor)

Sign In for Pricing
View Details
Lung Tissue Slide (Tumor)
MBS154231-02 10 um

Lung Tissue Slide (Tumor)

Sign In for Pricing
View Details
Lung Tissue Slide (Tumor)
MBS154231-03 5x 10 um

Lung Tissue Slide (Tumor)

Sign In for Pricing
View Details
HPV11 antibody
10-P25B 200 ug

HPV11 antibody

Sign In for Pricing
View Details
LYSMD1 siRNA (h)
sc-88211 10 µM

LYSMD1 siRNA (h)

Sign In for Pricing
View Details
NUP43 Rabbit Polyclonal Antibody (BF350)
orb2468259 100 µL

NUP43 Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details