Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GYS1 Peptide - C-terminal region

GYS1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GSY, GYS

UniProt

P13807

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GYS1 Rabbit Polyclonal Antibody (orb589861) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001155059.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FTYEPNEADAAQGYRYPRPASVPPSPSLSRHSSPHQSEDEEDPRNGPLEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-p95 NBS1/NBN Antibody Picoband® Fluoro488 Conjugated
PB9615-Fluoro488 100 µg/Vial

Anti-p95 NBS1/NBN Antibody Picoband® Fluoro488 Conjugated

Sign In for Pricing
View Details
5T4 recombinant monoclonal antibody
A5271 100ul X 3

5T4 recombinant monoclonal antibody

Sign In for Pricing
View Details
SS Beads 3.2mm RNase Free
SSB32-RNA 10 mL

SS Beads 3.2mm RNase Free

Sign In for Pricing
View Details
BMS-986020 sodium
T63439-01 10 mg

BMS-986020 sodium

Sign In for Pricing
View Details
BMS-986020 sodium
T63439-02 5 mg

BMS-986020 sodium

Sign In for Pricing
View Details
BMS-986020 sodium
T63439-03 1 mg

BMS-986020 sodium

Sign In for Pricing
View Details