IMMT Peptide - middle region
IMMT Peptide - middle region
Product Specifications
Product Name Alternative
HMP, P87, P89, PIG4, Mic60, PIG52, MINOS2, P87/89
UniProt
Q16891
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with IMMT Rabbit Polyclonal Antibody (orb589862) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001093639.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SIQSGPLKISSVSEVMKESKQPASQLQKQKGDTPASATAPTEAAQIISAA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS2166678-01 0.1 mL
Cy3-Linked Monoclonal Antibody to Cluster of Differentiation 79B (CD79B)
Sign In for Pricing
View Details MBS2166678-02 0.2 mL
Cy3-Linked Monoclonal Antibody to Cluster of Differentiation 79B (CD79B)
Sign In for Pricing
View Details MBS2166678-03 0.5 mL
Cy3-Linked Monoclonal Antibody to Cluster of Differentiation 79B (CD79B)
Sign In for Pricing
View Details MBS2166678-04 1 mL
Cy3-Linked Monoclonal Antibody to Cluster of Differentiation 79B (CD79B)
Sign In for Pricing
View Details MBS2166678-05 5 mL
Cy3-Linked Monoclonal Antibody to Cluster of Differentiation 79B (CD79B)
Sign In for Pricing
View Details MBS2166678-06 5x 5 mL
Cy3-Linked Monoclonal Antibody to Cluster of Differentiation 79B (CD79B)
Sign In for Pricing
View Details