IMMT Peptide - middle region
IMMT Peptide - middle region
Product Specifications
Product Name Alternative
HMP, P87, P89, PIG4, Mic60, PIG52, MINOS2, P87/89
UniProt
Q16891
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with IMMT Rabbit Polyclonal Antibody (orb589862) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001093639.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SIQSGPLKISSVSEVMKESKQPASQLQKQKGDTPASATAPTEAAQIISAA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC402475-500 1x 500 µL
GLUT-1 (Tumor Progression and Mesothelioma Marker) (GLUT1/2475), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC941983-500 1x 500 µL
Carcinoembryonic Antigen (CEA) / CD66 (C66/1983R), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![APC Anti-Human CD41 Antibody[10E5-F0061]](https://cdn.genprice.uk/products/763/686898d6994c49e6dcfd02b2/imageurl/an00332e.webp)
