Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DCTN1 Peptide - middle region

DCTN1 Peptide - middle region

Product Specifications

Product Name Alternative

P135, DP-150, DAP-150

UniProt

Q14203

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DCTN1 Rabbit Polyclonal Antibody (orb589869) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001128512.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PYECLRQSCNILISTMNKLATAMQEGEYDAERPPSKPPPVELRAAALRAE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mitofusin-2 (Mfn2, Mitofusin-2, Transmembrane GTPase MFN2) (MaxLight 550)
029540-ML550 100 µL

Mitofusin-2 (Mfn2, Mitofusin-2, Transmembrane GTPase MFN2) (MaxLight 550)

Sign In for Pricing
View Details
Rabbit Anti Human OTX1 Polyclonal Antigen Affinity Purified (PBS with 0.05% sodium azide and 40% Glycerol, pH7.4) (IHC,ELISA) 200UL
IRBAMLOTX1AAP08200UL 200 µL

Rabbit Anti Human OTX1 Polyclonal Antigen Affinity Purified (PBS with 0.05% sodium azide and 40% Glycerol, pH7.4) (IHC,ELISA) 200UL

Sign In for Pricing
View Details
Anti-TCEB2 antibody
STJ27315 100 µl

Anti-TCEB2 antibody

Sign In for Pricing
View Details
ADAMTS17 Antibody (Center) [APR33220G]
APR33220G-01 50 µL

ADAMTS17 Antibody (Center) [APR33220G]

Sign In for Pricing
View Details
ADAMTS17 Antibody (Center) [APR33220G]
APR33220G-02 100 µL

ADAMTS17 Antibody (Center) [APR33220G]

Sign In for Pricing
View Details
ADAMTS17 Antibody (Center) [APR33220G]
APR33220G-03 200 µL

ADAMTS17 Antibody (Center) [APR33220G]

Sign In for Pricing
View Details