Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KALRN Peptide - middle region

KALRN Peptide - middle region

Product Specifications

Product Name Alternative

DUO, CHD5, DUET, TRAD, CHDS5, HAPIP, ARHGEF24

UniProt

O60229

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KALRN Rabbit Polyclonal Antibody (orb589872) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001019831.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GRKSFDLGSPKPGDETTPQGDSADEKSKKGWGEDEPDEESHTPLPPPMKI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thrap3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
46668114 3x 1.0 µg

Thrap3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
DPAGT1 Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb2514925 100 µL

DPAGT1 Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details
RGD1309735 siRNA Oligos set (Rat)
39077176 3x 5 nmol

RGD1309735 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
Mouse Microtubule Associated Protein 1A (MAP1A) ELISA Kit
orb1664955-01 48 Tests

Mouse Microtubule Associated Protein 1A (MAP1A) ELISA Kit

Sign In for Pricing
View Details
Mouse Microtubule Associated Protein 1A (MAP1A) ELISA Kit
orb1664955-02 96 Tests

Mouse Microtubule Associated Protein 1A (MAP1A) ELISA Kit

Sign In for Pricing
View Details
Phospho-Histone H1 (Thr17) Antibody
A10904-100UG 100 µg

Phospho-Histone H1 (Thr17) Antibody

Sign In for Pricing
View Details