Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EYA4 Peptide - middle region

EYA4 Peptide - middle region

Product Specifications

Product Name Alternative

CMD1J, DFNA10

UniProt

O95677

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EYA4 Rabbit Polyclonal Antibody (orb589873) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_004091.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QESLPGLTNQPGEFDTMQSPSTPIKDLDERTCRSSGSKSRGRGRKNNPSP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Free-Thyroxine 4 ELISA Kit (Mouse) (OKCA00139)
OKCA00139 96 Well

Free-Thyroxine 4 ELISA Kit (Mouse) (OKCA00139)

Sign In for Pricing
View Details
Leucine Rich Repeats And Death Domain Containing Protein (LRDD) Polyclonal Antibody
CAU24110-01 100 µL

Leucine Rich Repeats And Death Domain Containing Protein (LRDD) Polyclonal Antibody

Sign In for Pricing
View Details
Leucine Rich Repeats And Death Domain Containing Protein (LRDD) Polyclonal Antibody
CAU24110-02 200 µL

Leucine Rich Repeats And Death Domain Containing Protein (LRDD) Polyclonal Antibody

Sign In for Pricing
View Details
Leucine Rich Repeats And Death Domain Containing Protein (LRDD) Polyclonal Antibody
CAU24110-03 1 mL

Leucine Rich Repeats And Death Domain Containing Protein (LRDD) Polyclonal Antibody

Sign In for Pricing
View Details
Human Myb-related protein B,MYBL2 ELISA KIT
JOT-EK5707Hu-01 96 Well

Human Myb-related protein B,MYBL2 ELISA KIT

Sign In for Pricing
View Details
Human Myb-related protein B,MYBL2 ELISA KIT
JOT-EK5707Hu-02 48 Well

Human Myb-related protein B,MYBL2 ELISA KIT

Sign In for Pricing
View Details